UniProtKB/Swiss-Prot PTM Description

N-glycosylated; glycans consist in Man9(GlcNAc)2 and Man7(GlcNAc)2 when dually glycosylated at Asn-258 and Asn-347, whereas it consists in Xyl-Man3(GlcNAc)2 when solely glycosylated at Asn-258

Glycosylation Sites

Position Structures Description Evidence
ASN-258, ASN-347 Associated Structures: 2 global GlycoSuite
Site-Specific Information

A number of glycan structures have been assigned to specific glycosylation sites

Position Structures Description Evidence
ASN-258 Associated Structures: 1 Site specific GlycoSuite
ASN-347 Associated Structures: 1 Site specific GlycoSuite

Glycan Structures

Notes

Accompanying information sourced from GlycoSuiteDB

  1. ASN-258 & ASN-347 [STURM ET AL. (1987) J. BIOL. CHEM. 262:13392-13403

Sequence

MMRARVPLLLLGILFLASLSASFATSLREEEESQDNPFYFNSDNSWNTLFKNQYGHIRVLQRFDQQSKRLQNLEDYRLVEFRSKPETLLLPQQADAELLLVVRSGSAILVLVKPDDRREYFFLTQGDNPIFSDNQKIPAGTIFYLVNPDPKEDLRIIQLAMPVNNPQIHEFFLSSTEAQQSYLQEFSKHILEASFNSKFEEINRVLFEEEGQQEEGQQEGVIVNIDSEQIEELSKHAKSSSRKSHSKQDNTIGNEFGNLTERTDNSLNVLISSIEMKEGALFVPHYYSKAIVILVVNEGEAHVELVGPKGNKETLEFESYRAELSKDDVFVIPAAYPVAIKATSNVNFTGFGINANNNNRNLLAGKTDNVISSIGRALDGKDVLGLTFSGSGEEVMKLINKQSGSYFVDGHHHQQEQQKGSHQQEQQKGRKGAFVY