Associated Structures
Accession: P01233 UniProtKB/Swiss-Prot Entry
UniProtKB/Swiss-Prot PTM Description
No UniProt PTM information available. Unable to query UniProt for this accession number(s).
Glycosylation Sites
Position | Structures | Description | Evidence |
---|---|---|---|
ASN-33, ASN-50, SER-141, SER-147, SER-152, SER-158 | Associated Structures: 15 | global | GlycoSuite |
Site-Specific Information
A number of glycan structures have been assigned to specific glycosylation sites
Position | Structures | Description | Evidence |
---|---|---|---|
ASN-33 | Associated Structures: 1 | Site specific | GlycoSuite |
ASN-33 AND ASN-50 | Associated Structures: 2 | Site specific | GlycoSuite |
Notes
Accompanying information sourced from GlycoSuiteDB
- ASN-33, ASN-50, SER-141, SER-147, SER-152 & SER-158 [MORGAN ET AL. (1975) J. BIOL. CHEM. 250:5247-5258
Sequence
MEMFQGLLLLLLLSMGGTWASKEPLRPRCRPINATLAVEKEGCPVCITVNTTICAGYCPTMTRVLQGVLPALPQVVCNYRDVRFESIRLPGCPRGVNPVVSYAVALSCQCALCRRSTTDCGGPKDHPLTCDDPRFQDSSSSKAPPPSLPSPSRLPGPSDTPILPQ