UniProtKB/Swiss-Prot PTM Description

No UniProt PTM information available. Unable to query UniProt for this accession number(s).

Glycosylation Sites

Position Structures Description Evidence
ASN-33, ASN-50, SER-141, SER-147, SER-152, SER-158 Associated Structures: 15 global GlycoSuite
Site-Specific Information

A number of glycan structures have been assigned to specific glycosylation sites

Position Structures Description Evidence
ASN-33 Associated Structures: 1 Site specific GlycoSuite
ASN-33 AND ASN-50 Associated Structures: 2 Site specific GlycoSuite

Notes

Accompanying information sourced from GlycoSuiteDB

  1. ASN-33, ASN-50, SER-141, SER-147, SER-152 & SER-158 [MORGAN ET AL. (1975) J. BIOL. CHEM. 250:5247-5258

Sequence

MEMFQGLLLLLLLSMGGTWASKEPLRPRCRPINATLAVEKEGCPVCITVNTTICAGYCPTMTRVLQGVLPALPQVVCNYRDVRFESIRLPGCPRGVNPVVSYAVALSCQCALCRRSTTDCGGPKDHPLTCDDPRFQDSSSSKAPPPSLPSPSRLPGPSDTPILPQ