UniProtKB/Swiss-Prot PTM Description

N-glycans are core-fucosylated, heterogeneous and short which could be the result of extensive trimming

Glycosylation Sites

Position Structures Description Evidence
ASN-9 Associated Structures: 9 global GlycoSuite
Site-Specific Information

A number of glycan structures have been assigned to specific glycosylation sites

Position Structures Description Evidence
ASN-9 Associated Structures: 9 Site specific GlycoSuite

Glycan Structures

Notes

Accompanying information sourced from GlycoSuiteDB

  1. ASN-9 [HASSANI ET AL. (1999) FEBS LETT. 443:175-180

Sequence

GRDGYVVKNGTNCKYSCEIGSEYEYCGPLCKRKNAKTGYCYAFACWCIDVPDDVKLYGDDGTYCSS

References 1

  1. Aah VI, a novel, N-glycosylated anti-insect toxin from Androctonus australis hector scorpion venom: isolation, characterisation, and glycan structure determination.

    Hassani O, Loew D, Van Dorsselaer A, Papandrou M, Sorokine O, Rochat H, Sampieri F, Mansuelle P

    PubMed: 9989600 Year: 1999