UniProtKB/Swiss-Prot PTM Description

At least two differentially glycosylated forms are found. Glycodelin-A (GdA) (amniotic fluid) with contraceptive and immunosuppressive activities and glycodelin-S (Gds) (seminal plasma) whose role is not yet known. The gender-specific glycosylation may serve to regulate key process involved in human reproduction

Glycosylation Sites

Position Structures Description Evidence
ASN-46, ASN-81 Associated Structures: 20 global GlycoSuite
Site-Specific Information

A number of glycan structures have been assigned to specific glycosylation sites

Position Structures Description Evidence
ASN-46 Associated Structures: 11 Site specific GlycoSuite
ASN-46 AND ASN-81 Associated Structures: 2 Site specific GlycoSuite
ASN-81 Associated Structures: 7 Site specific GlycoSuite

Notes

Accompanying information sourced from GlycoSuiteDB

  1. ASN-46 AND ASN-81 [DELL ET AL. (1995) J. BIOL. CHEM. 270:24116-24126

Sequence

MLCLLLTLGVALVCGVPAMDIPQTKQDLELPKLAGTWHSMAMATNNISLMATLKAPLRVHITSLLPTPEDNLEIVLHRWENNSCVEKKVLGEKTENPKKFKINYTVANEATLLDTDYDNFLFLCLQDTTTPIQSMMCQYLARVLVEDDEIMQGFIRAFRPLPRHLWYLLDLKQMEEPCRF

References 1

  1. Structural analysis of the oligosaccharides derived from glycodelin, a human glycoprotein with potent immunosuppressive and contraceptive activities.

    Dell A, Morris H, Easton R, Panico M, Patankar M, Oehniger S, Koistinen R, Koistinen H, Seppala M, Clark G

    PubMed: 7592613 Year: 1995