Associated Structures
Accession: P40225 UniProtKB/Swiss-Prot Entry
UniProtKB/Swiss-Prot PTM Description
No UniProt PTM information available. Unable to query UniProt for this accession number(s).
Glycosylation Sites
Position | Structures | Description | Evidence |
---|---|---|---|
Associated Structures: 16 | global | GlycoSuite |
Site-Specific Information
A number of glycan structures have been assigned to specific glycosylation sites
Position | Structures | Description | Evidence |
---|---|---|---|
ASN-197, ASN-206, ASN-234, ASN-255 | Associated Structures: 12 | Site specific | GlycoSuite |
Notes
Accompanying information sourced from GlycoSuiteDB
Sequence
MELTELLLVVMLLLTARLTLSSPAPPACDLRVLSKLLRDSHVLHSRLSQCPEVHPLPTPVLLPAVDFSLGEWKTQMEETKAQDILGAVTLLLEGVMAARGQLGPTCLSSLLGQLSGQVRLLLGALQSLLGTQLPPQGRTTAHKDPNAIFLSFQHLLRGKVRFLMLVGGSTLCVRRAPPTTAVPSRTSLVLTLNELPNRTSGLLETNFTASARTTGSGLLKWQQGFRAKIPGLLNQTSRSLDQIPGYLNRIHELLNGTRGLFPGPSRRTLGAPDISSGTSDTGSLPPNLQPGYSPSPTHPPTGQYTLFPLPPTLPTPVVQLHPLLPDPSAPTPTPTSPLLNTSYTHSQNLSQEG