UniProtKB/Swiss-Prot PTM Description

No UniProt PTM information available. Unable to query UniProt for this accession number(s).

Glycosylation Sites

Position Structures Description Evidence
ASN-51, ASN-65, ASN-110 Associated Structures: 10 global GlycoSuite
Position Structures Description Evidence
Associated Structures: 23 global GlycoSuite
Position Structures Description Evidence
ASN-51, ASN-65, ASN-110, SER-153 Associated Structures: 93 global GlycoSuite
Site-Specific Information

A number of glycan structures have been assigned to specific glycosylation sites

Position Structures Description Evidence
ASN-110 Associated Structures: 4 Site specific GlycoSuite
ASN-51 Associated Structures: 17 Site specific GlycoSuite
ASN-51 AND ASN-110 Associated Structures: 2 Site specific GlycoSuite
ASN-51 AND ASN-65 Associated Structures: 2 Site specific GlycoSuite
ASN-51, ASN-65 AND ASN-110 Associated Structures: 6 Site specific GlycoSuite
ASN-65 Associated Structures: 2 Site specific GlycoSuite

Notes

Accompanying information sourced from GlycoSuiteDB

  1. ASN-51, ASN-65 AND ASN-110 [NIMTZ ET AL. (1993) EUR. J. BIOCHEM. 213:39-56
  2. ASN-51, ASN-65, ASN-110 & SER-153 [SASAKI ET AL. (1988) BIOCHEMISTRY 27:8618-8626
  3. ASN-51, ASN-65, ASN-110 & SER-153 [SASAKI ET AL. (1988) BIOCHEMISTRY 27:8618-8626
  4. ASN-51, ASN-65, ASN-110 & SER-153 [SASAKI ET AL. (1988) BIOCHEMISTRY 27:8618-8626
  5. ASN-51, ASN-65, ASN-110 AND SER-153 [COINTE ET AL. (2000) GLYCOBIOLOGY 10:511-509

Sequence

MGVHECPAWLWLLLSLLSLPLGLPVLGAPPRLICDSRVLERYLLEAKEAENITTGCAEHCSLNENITVPDTKVNFYAWKRMEVGQQAVEVWQGLALLSEAVLRGQALLVNSSQPWEPLQLHVDKAVSGLRSLTTLLRALGAQKEAISPPDAASAAPLRTITADTFRKLFRVYSNFLRGKLKLYTGEACRTGDR

References showing top 5 17

  1. Comparative study of the asparagine-linked sugar chains of human erythropoietins purified from urine and the culture medium of recombinant Chinese hamster ovary cells.

    Takeuchi M, Takasaki S, Miyazaki H, Kato T, Hoshi S, Kochibe N, Kobata A

    PubMed: 3346214 Year: 1988

  2. Unusual N-glycosylation of a recombinant human erythropoietin expressed in a human lymphoblastoid cell line does not alter its biological properties.

    Cointe D, Bliard R, Jorieux S, Leroy Y, Glacet A, Verbert A, Bourel D, Chirat F

    PubMed: 10764840 Year: 2000

  3. Determination of the branch location of extra N-acetyllactosamine units in sialo N-linked tetraantennary oligosaccharides.

    Hokke C, Kamerling J, van Dedem G, Vliegenthart J

    PubMed: 1907570 Year: 1991

  4. Biological and physicochemical characterization of recombinant human erythropoietins fractionated by Mono Q column chromatography and their modification with sialyltransferase.

    Morimoto K, Tsuda E, Said A, Uchida E, Hatakeyama S, Ueda M, Hayakawa T

    PubMed: 8981093 Year: 1996

  5. Sialylated carbohydrate chains of recombinant human glycoproteins expressed in Chinese hamster ovary cells contain traces of N-glycolylneuraminic acid.

    Hokke C, Bergwerff A, van Dedem G, van Oostrum J, Kamerling J, Vliegenthart J

    PubMed: 2124546 Year: 1990

  6. Recombinant human erythropoietin produced by Namalwa cells.

    Yanagi H, Yoshima T, Ogawa I, Okamoto M

    PubMed: 2550193 Year: 1989

  7. A strategy for the mapping of N-glycans by high-performance capillary electrophoresis.

    Hermentin P, Doenges R, Witzel R, Hokke C, Vliegenthart J, Kamerling J, Conradt H, Nimtz M, Brazel D

    PubMed: 7527189 Year: 1994

  8. Structures of sialylated oligosaccharides of human erythropoietin expressed in recombinant BHK-21 cells.

    Nimtz M, Martin W, Wray V, Klppel K, Augustin J, Conradt H

    PubMed: 8477709 Year: 1993

  9. Relationship between sugar chain structure and biological activity of recombinant human erythropoietin produced in Chinese hamster ovary cells.

    Takeuchi M, Inoue N, Strickland T, Kubota M, Wada M, Shimizu R, Hoshi S, Kozutsumi H, Takasaki S, Kobata A

    PubMed: 2813359 Year: 1989

  10. Structural analysis of the sialylated N- and O-linked carbohydrate chains of recombinant human erythropoietin expressed in Chinese hamster ovary cells. Sialylation patterns and branch location of dimeric N-acetyllactosamine units.

    Hokke C, Bergwerff A, Van Dedem G, Kamerling J, Vliegenthart J

    PubMed: 7737204 Year: 1995

  11. Structures of mucin-type sugar chains on human erythropoietins purified from urine and the culture medium of recombinant Chinese hamster ovary cells.

    Inoue N, Takeuchi M, Asano K, Shimizu R, Takasaki S, Kobata A

    PubMed: 8460945 Year: 1993

  12. Quantitative mapping of the N-linked sialyloligosaccharides of recombinant erythropoietin: combination of direct high-performance anion-exchange chromatography and 2-aminopyridine derivatization.

    Rice K, Takahashi N, Namiki Y, Tran A, Lisi P, Lee Y

    PubMed: 1443598 Year: 1992

  13. Identification and structural characterization of a mannose-6-phosphate containing oligomannosidic N-glycan from human erythropoietin secreted by recombinant BHK-21 cells.

    Nimtz M, Wray V, Rdiger A, Conradt H

    PubMed: 7781780 Year: 1995

  14. Comparative structural study of N-linked oligosaccharides of urinary and recombinant erythropoietins.

    Tsuda E, Goto M, Murakami A, Akai K, Ueda M, Kawanishi G, Takahashi N, Sasaki R, Chiba H, Ishihara H

    PubMed: 3179269 Year: 1988

  15. Structural analysis of sulfated N-linked oligosaccharides in erythropoietin

    Kawasaki, Haishima, Ohta, Itoh, Hyuga, Hayakawa

    PubMed: 11805077 Year: 2001

  16. New N-linked glycans found on Erythropoietin

    Packer N, Karlsson N

    PubMed: Year: 2005

  17. See more references
    ● ● ●