UniProtKB/Swiss-Prot PTM Description

No UniProt PTM information available. Unable to query UniProt for this accession number(s).

Glycosylation Sites

Position Structures Description Evidence
ASN-207, THR-558, THR-569, THR-579, THR-596, THR-607, THR-618, THR-629, THR-640, THR-651, THR-662 Associated Structures: 17 global GlycoSuite
Site-Specific Information

A number of glycan structures have been assigned to specific glycosylation sites

Position Structures Description Evidence
ASN-207 Associated Structures: 4 Site specific GlycoSuite

Notes

Accompanying information sourced from GlycoSuiteDB

  1. ASN-207 [ONLY POSSIBLE ASN-GLYCOSYLATION SITE
  2. THR-558, THR-569, THR-579, THR-596, THR-607, THR-618, THR-629, THR-640, THR-651 & THR-662 [WANG ET AL. (1995) BIOCHEMISTRY 34:10639-10644

Sequence

MGRLQLVVLGLTCCWAVASAAKLGAVYTEGGFVEGVNKKLGLLGDSVDIFKGIPFAAPTKALENPQPHPGWQGTLKAKNFKKRCLQATITQDSTYGDEDCLYLNIWVPQGRKQVSRDLPVMIWIYGGAFLMGSGHGANFLNNYLYDGEEIATRGNVIVVTFNYRVGPLGFLSTGDANLPGNYGLRDQHMAIAWVKRNIAAFGGDPNNITLFGESAGGASVSLQTLSPYNKGLIRRAISQSGVALSPWVIQKNPLFWAKKVAEKVGCPVGDAARMAQCLKVTDPRALTLAYKVPLAGLEYPMLHYVGFVPVIDGDFIPADPINLYANAADIDYIAGTNNMDGHIFASIDMPAINKGNKKVTEEDFYKLVSEFTITKGLRGAKTTFDVYTESWAQDPSQENKKKTVVDFETDVLFLVPTEIALAQHRANAKSAKTYAYLFSHPSRMPVYPKWVGADHADDIQYVFGKPFATPTGYRPQDRTVSKAMIAYWTNFAKTGDPNMGDSAVPTHWEPYTTENSGYLEITKKMGSSSMKRSLRTNFLRYWTLTYLALPTVTDQEATPVPPTGDSEATPVPPTGDSETAPVPPTGDSGAPPVPPTGDSGAPPVPPTGDSGAPPVPPTGDSGAPPVPPTGDSGAPPVPPTGDSGAPPVPPTGDSGAPPVPPTGDSGAPPVPPTGDAGPPPVPPTGDSGAPPVPPTGDSGAPPVTPTGDSETAPVPPTGDSGAPPVPPTGDSEAAPVPPTDDSKEAQMPAVIRF

References 4

  1. Variation of the glycosylation of human pancreatic bile-salt-dependent lipase.

    Mas E, Abouakil N, Roudani S, Franc J, Montreuil J, Lombardo D

    PubMed: 8404899 Year: 1993

  2. Structural characterization of the N-linked oligosaccharides in bile salt-stimulated lipase originated from human breast milk.

    Mechref Y, Chen P, Novotny M

    PubMed: 10024660 Year: 1999

  3. Characterization of N- and O-linked glycosylation of recombinant human bile salt-stimulated lipase secreted by Pichia pastoris

    Trimble RB, Lubowski C, Hauer CR III, Stack R, McNaughton L, Gemmill TR, Kumar SA

    PubMed: 14693913 Year: 2004

  4. The structure of N-linked oligosaccharides of human pancreatic bile-salt-dependent lipase.

    Sugo T, Mas E, Abouakil N, Endo T, Escribano M, Kobata A, Lombardo D

    PubMed: 8404898 Year: 1993