UniProtKB/Swiss-Prot PTM Description

The N-terminal extracellular domain is heavily glycosylated on serine and threonine residues

Glycosylation Sites

Position Structures Description Evidence
Associated Structures: 6 global GlycoSuite
Position Structures Description Evidence
SER-21, THR-22, THR-23, THR-29, SER-30, THR-31, SER-32, THR-36, SER-38, SER-41, THR-44, ASN-45, THR-52, THR-56, SER-63, SER-66, THR-69 Associated Structures: 4 global GlycoSuite

Glycan Structures

Notes

Accompanying information sourced from GlycoSuiteDB

  1. SER-21, THR-22, THR-23, THR-29, SER-30, THR-31, SER-32, THR-36, SER-38, SER-41, THR-44, ASN-45, THR-52, THR-56, SER-63, SER-66 & THR-69 [PISANO ET AL. (1993) GLYCOBIOLOGY 3:429-435

Sequence

MYGKIIFVLLLSEIVSISALSTTEVAMHTSTSSSVTKSYISSQTNGETGQLVHRFTVPAPVVIILIILCVMAGIIGTILLISYSIRRLIKA

References 3

  1. Structures of novel sialylated O-linked oligosaccharides isolated from human erythrocyte glycophorins.

    Fukuda M, Lauffenburger M, Sasaki H, Rogers ME, Dell A

    PubMed: 3624241 Year: 1987

  2. O-linked oligosaccharides of glycophorins A and B in erythrocytes of two individuals with the Tn polyagglutinability syndrome.

    Blumenfeld O, Lalezari P, Khorshidi M, Puglia K, Fukuda M

    PubMed: 1421410 Year: 1992

  3. Membrane glycophorins of Dantu blood group erythrocytes.

    Blumenfeld O, Smith A, Moulds J

    PubMed: 3305497 Year: 1987