Associated Structures
Accession: P02752 UniProtKB/Swiss-Prot Entry
UniProtKB/Swiss-Prot PTM Description
Plasma and yolk RBPS have the same carbohydrate components, whereas egg-white RBP has a different, ovomucoid-type carbohydrate chain, Plasma RBP has the same C-terminal sequence as the egg-white RBP, which suggests that the C-terminal residues are cleaved off upon incorporation into the oocyte
Glycosylation Sites
Position | Structures | Description | Evidence |
---|---|---|---|
ASN-53, ASN-164 | Associated Structures: 35 | global | GlycoSuite |
Site-Specific Information
A number of glycan structures have been assigned to specific glycosylation sites
Position | Structures | Description | Evidence |
---|---|---|---|
ASN-53 AND ASN-164 | Associated Structures: 3 | Site specific | GlycoSuite |
Notes
Accompanying information sourced from GlycoSuiteDB
- ASN-53 AND ASN-164 [ROHRER AND WHITE(1992) BIOCHEM J 285:275-280
- ASN-53 & ASN-164 [ROHRER AND WHITE (1992) BIOCHEM. J. 285:275-280
Sequence
MLRFAITLFAVITSSTCQQYGCLEGDTHKANPSPEPNMHECTLYSESSCCYANFTEQLAHSPIIKVSNSYWNRCGQLSKSCEDFTKKIECFYRCSPHAARWIDPRYTAAIQSVPLCQSFCDDWYEACKDDSICAHNWLTDWERDESGENHCKSKCVPYSEMYANGTDMCQSMWGESFKVSESSCLCLQMNKKDMVAIKHLLSESSEESSSMSSSEEHACQKKLLKFEALQQEEGEERR
Biological Associations
References 3
-
Structures of sugar chains of hen egg yolk riboflavin-binding protein.
PubMed: 8370663 Year: 1993
-
PubMed: 1637312 Year: 1992
-
Composition of the N-linked carbohydrates from ovalbumin and co-purified glycoproteins.
PubMed: 10833030 Year: 2000