UniProtKB/Swiss-Prot PTM Description

Proteolytic processing produces C-terminal heterogeneity, with proteins ending alternatively at Gly-150, Met-157 or Gly-161

Notes

Accompanying information sourced from GlycoSuiteDB

Sequence

MKYTSYILAFQLCIVLGSLGCYCQDPYVKEAENLKKYFNAGHSDVADNGTLFLGILKNWKEESDRKIMQSQIVSFYFKLFKNFKDDQSIQKSVETIKEDMNVKFFNSNKKKRDDFEKLTNYSVTDLNVQRKAIHELIQVMAELSPAAKTGKRKRSQMLFRGRRASQ

References 2

  1. The widespread effect of beta 1,4-galactosyltransferase on N-glycan processing

    Fukuta, Abe, Yokomatsu, Minowa, Takeuchi, Asanagi, Makino

    PubMed: 11469797 Year: 2001

  2. Remodeling of sugar chain structures of human interferon-gamma.

    Fukuta K, Abe R, Yokomatsu T, Kono N, Asanagi M, Omae F, Minowa M, Takeuchi M, Makino T

    PubMed: 10764830 Year: 2000