UniProtKB/Swiss-Prot PTM Description

The activity of TIMP1 is dependent on the presence of disulfide bonds

Glycosylation Sites

Position Structures Description Evidence
ASN-53, ASN-101 Associated Structures: 22 global GlycoSuite
Site-Specific Information

A number of glycan structures have been assigned to specific glycosylation sites

Position Structures Description Evidence
ASN-101 Associated Structures: 2 Site specific GlycoSuite
ASN-53 Associated Structures: 5 Site specific GlycoSuite
ASN-53 AND ASN-101 Associated Structures: 15 Site specific GlycoSuite

Notes

Accompanying information sourced from GlycoSuiteDB

  1. ASN-53 AND ASN-101 [SUTTON ET AL. (1994) ANAL. BIOCHEM. 218:34-46

Sequence

MAPFEPLASGILLLLWLIAPSRACTCVPPHPQTAFCNSDLVIRAKFVGTPEVNQTTLYQRYEIKMTKMYKGFQALGDAADIRFVYTPAMESVCGYFHRSHNRSEEFLIAGKLQDGLLHITTCSFVAPWNSLSLAQRRGFTKTYTVGCEECTVFPCLSIPCKLQSGTHCLWTDQLLQGSEKGFQSRHLACLPREPGLCTWQSLRSQIA