UniProtKB/Swiss-Prot PTM Description

Phosphorylated on some or all of the serine and threonine residues present in the C-terminal region, Contains one covalently linked retinal chromophore

Glycosylation Sites

Position Structures Description Evidence
ASN-2, ASN-15 Associated Structures: 4 global GlycoSuite

Glycan Structures

Notes

Accompanying information sourced from GlycoSuiteDB

  1. ASN-2 & ASN-15 [HARGRAVE (1977) BIOCHIM. BIOPHYS. ACTA 492:83-94

Sequence

MNGTEGPNFYVPFSNKTGVVRSPFEAPQYYLAEPWQFSMLAAYMFLLIMLGFPINFLTLYVTVQHKKLRTPLNYILLNLAVADLFMVFGGFTTTLYTSLHGYFVFGPTGCNLEGFFATLGGEIALWSLVVLAIERYVVVCKPMSNFRFGENHAIMGVAFTWVMALACAAPPLVGWSRYIPEGMQCSCGIDYYTPHEETNNESFVIYMFVVHFIIPLIVIFFCYGQLVFTVKEAAAQQQESATTQKAEKEVTRMVIIMVIAFLICWLPYAGVAFYIFTHQGSDFGPIFMTIPAFFAKTSAVYNPVIYIMMNKQFRNCMVTTLCCGKNPLGDDEASTTVSKTETSQVAPA

References showing top 5 6

  1. Identification and oligosaccharide structure analysis of rhodopsin glycoforms containing galactose and sialic acid.

    Duffin K, Lange G, Welply J, Florman R, O'Brien P, Dell A, Reason A, Morris H, Fliesler S

    PubMed: 8400551 Year: 1993

  2. Structural studies of the N-linked sugar chains of human rhodopsin.

    Fujita S, Endo T, Ju J, Kean E, Kobata A

    PubMed: 7881178 Year: 1994

  3. Retinal GlcNAc-transferases and the glycosylation of rhodopsin.

    Ju J, Kean E

    PubMed: 9492758 Year: 1994

  4. Rhodopsin carbohydrate. Structure of small oligosaccharides attached at two sites near the NH2 terminus

    Fukuda M, Papermaster D, Hargrave P

    PubMed: 468821 Year: 1979

  5. Structure of the carbohydrate moieties of bovine rhodopsin

    Liang C-J, Yamashita K, Muellenberg C, Shichi H, Kobata A

    PubMed: 447724 Year: 1979

  6. See more references
    ● ● ●