UniProtKB/Swiss-Prot PTM Description

No UniProt PTM information available. Unable to query UniProt for this accession number(s).

Glycosylation Sites

Position Structures Description Evidence
ASN-49, ASN-59, ASN-162 Associated Structures: 9 global GlycoSuite
Site-Specific Information

A number of glycan structures have been assigned to specific glycosylation sites

Position Structures Description Evidence
ASN-162 Associated Structures: 2 Site specific GlycoSuite
ASN-49 Associated Structures: 4 Site specific GlycoSuite
ASN-59 Associated Structures: 2 Site specific GlycoSuite
ASN-59 AND ASN-162 Associated Structures: 1 Site specific GlycoSuite

Glycan Structures

Notes

Accompanying information sourced from GlycoSuiteDB

  1. ASN-49, ASN-59 AND ASN-162 [OXLEY ET AL. (1998) J. BIOCHEM. 123:978-983

Sequence

MLNSPLTSVLFVLLFVLSPIYGAFEYMQLVLQWPTAFCHTTPCKRIPNNFTIHGLWPDNVSTTLNYCAAKENFKNIEDDTKKDDLYKRWPDLTTAETYCKQHQNFWRHEYNKHGKCCSESYNREQYFDLAMALKDKFDLLSSLRNHGIIPGRGMKYTVQKINSTIKKITQGYPNLSCTKGIMELVEIGICFDSMVKNVINCPHPKTCKPTGSNEIKFP