UniProtKB/Swiss-Prot PTM Description

The major O-linked glycan are NeuAc-alpha-(2-3)-Gal-beta-(1-3)-[NeuAc-alpha-(2-6)]-GalNAcOH (about 78 %) and NeuAc-alpha-(2-3)-Gal-beta-(1-3)-GalNAcOH (17 %). Minor O-glycans (5 %) include NeuAc-alpha-(2-3)-Gal-beta-(1-3)-[NeuAc-alpha-(2-6)]-GalNAcOH NeuAc-alpha-(2-8)-NeuAc-alpha-(2-3)-Gal-beta-(1-3)-GalNAcOH. About 1% of all O-linked glycans carry blood group A, B and H determinants. They derive from a type-2 precursor core structure, Gal-beta-(1,3)-GlcNAc-beta-1-R, and the antigens are synthesized by addition of fucose (H antigen-specific) and then N-acetylgalactosamine (A antigen-specific) or galactose (B antigen-specific). Specifically O-linked-glycans are NeuAc-alpha-(2-3)-Gal-beta-(1-3)-GalNAcOH-(6-1)-GlcNAc-beta-(4-1)-[Fuc-alpha-(1-2)]-Gal-beta-(3-1)-GalNAc-alpha (about 1%, B antigen-specific) and NeuAc-alpha-(2-3)-Gal-beta-(1-3)-GalNAcOH-(6-1)-GlcNAc-beta-(4-1)-[Fuc-alpha-(1-2)]-Gal-beta (1 %, O antigen-, A antigen- and B antigen-specific)

Glycosylation Sites

Position Structures Description Evidence
Associated Structures: 6 global GlycoSuite
Position Structures Description Evidence
Associated Structures: 2 global GlycoSuite
Position Structures Description Evidence
SER-21, THR-22, THR-23, THR-29, SER-30, THR-31, SER-32, THR-36, SER-38, SER-41, THR-44, ASN-45, THR-52, THR-56, SER-63, SER-66, THR-69 Associated Structures: 13 global GlycoSuite
Position Structures Description Evidence
SER-21, THR-22, THR-23, THR-29, SER-30, THR-31, SER-32, THR-36, SER-38, SER-41, THR-44, ASN-45, THR-52, THR-56, SER-63, SER-66, THR-69 Associated Structures: 4 global GlycoSuite

Notes

Accompanying information sourced from GlycoSuiteDB

  1. SER-21, THR-22, THR-23, THR-29, SER-30, THR-31, SER-32, THR-36, SER-38, SER-41, THR-44, ASN-45, THR-52, THR-56, SER-63, SER-66 & THR-69 [PISANO ET AL. (1993) GLYCOBIOLOGY 3:429-435
  2. SER-21, THR-22, THR-23, THR-29, SER-30, THR-31, SER-32, THR-36, SER-38, SER-41, THR-44, ASN-45, THR-52, THR-56, SER-63, SER-66 AND THR-69 [PISANO ET AL. (1993) GLYCOBIOLOGY 3:429-435

Sequence

MYGKIIFVLLLSEIVSISASSTTGVAMHTSTSSSVTKSYISSQTNDTHKRDTYAATPRAHEVSEISVRTVYPPEEETGERVQLAHHFSEPEITLIIFGVMAGVIGTILLISYGIRRLIKKSPSDVKPLPSPDTDVPLSSVEIENPETSDQ

References showing top 5 7

  1. A carbohydrate structural variant of MM glycoprotein (glycophorin A).

    Adamany A, Blumenfeld O, Sabo B, McCreary J

    PubMed: 6619126 Year: 1983

  2. Structure determination of oligosaccharides isolated from Cad erythrocyte membranes by permethylation analysis and 500-MHz 1H-NMR spectroscopy.

    Herkt F, Parente J, Leroy Y, Fournet B, Blanchard D, Cartron J, van Halbeek H, Vliegenthart J

    PubMed: 3967649 Year: 1985

  3. Primary structure of the oligosaccharide determinant of blood group Cad specificity.

    Blanchard D, Cartron J, Fournet B, Montreuil J, van Halbeek H, Vliegenthart J

    PubMed: 6190803 Year: 1983

  4. An improved approach to the analysis of the structure of small oligosaccharides of glycoproteins: application to the O-linked oligosaccharides from human glycophorin A.

    Krotkiewski H, Lisowska E, Nilsson G, Grnberg G, Nilsson B

    PubMed: 8384526 Year: 1993

  5. Membrane glycophorins in Sta blood group erythrocytes.

    Blumenfeld O, Adamany A, Kikuchi M, Sabo B, McCreary J

    PubMed: 3514617 Year: 1986

  6. Structures of the asparagine-linked sugar chains of glycophorin A.

    Yoshima H, Furthmayr H, Kobata A

    PubMed: 7430095 Year: 1980

  7. See more references
    ● ● ●