UniProtKB/Swiss-Prot PTM Description

Plasma and yolk RBPS have the same carbohydrate components, whereas egg-white RBP has a different, ovomucoid-type carbohydrate chain, Plasma RBP has the same C-terminal sequence as the egg-white RBP, which suggests that the C-terminal residues are cleaved off upon incorporation into the oocyte

Glycosylation Sites

Position Structures Description Evidence
ASN-53, ASN-164 Associated Structures: 35 global GlycoSuite
Site-Specific Information

A number of glycan structures have been assigned to specific glycosylation sites

Position Structures Description Evidence
ASN-53 AND ASN-164 Associated Structures: 3 Site specific GlycoSuite

Notes

Accompanying information sourced from GlycoSuiteDB

  1. ASN-53 AND ASN-164 [ROHRER AND WHITE(1992) BIOCHEM J 285:275-280
  2. ASN-53 & ASN-164 [ROHRER AND WHITE (1992) BIOCHEM. J. 285:275-280

Sequence

MLRFAITLFAVITSSTCQQYGCLEGDTHKANPSPEPNMHECTLYSESSCCYANFTEQLAHSPIIKVSNSYWNRCGQLSKSCEDFTKKIECFYRCSPHAARWIDPRYTAAIQSVPLCQSFCDDWYEACKDDSICAHNWLTDWERDESGENHCKSKCVPYSEMYANGTDMCQSMWGESFKVSESSCLCLQMNKKDMVAIKHLLSESSEESSSMSSSEEHACQKKLLKFEALQQEEGEERR