UniProtKB/Swiss-Prot PTM Description

No UniProt PTM information available. Unable to query UniProt for this accession number(s).

Notes

Accompanying information sourced from GlycoSuiteDB

Sequence

QTIATGSPPIAGTSDLSTITSAATPTFTTEQDGREQGDGLQLAHDFSQPVITVIILGVMAGIIGIILLLAYVSRRLRKRPPADVPPPASTVPSADAPPPVSEDDETSLTSVETDYPGDSQ

References showing top 5 9

  1. Isolation and structural studies of the neutral oligosaccharide units from bovine glycophorin.

    Fukuda K, Tomita M, Hamada A

    PubMed: 7295805 Year: 1981

  2. Amino acid and carbohydrate structural variants of glycoprotein products (M-N glycoproteins) of the M-N allelic locus.

    Blumenfeld O, Adamany A, Puglia K

    PubMed: 6940143 Year: 1981

  3. Isolation and characterization of alkali-labile oligosaccharide units from horse glycophorin.

    Fukuda K, Tomita M, Hamada A

    PubMed: 7390957 Year: 1980

  4. Structural analysis of the N-linked oligosaccharides from murine glycophorin.

    Angel A, Grnberg G, Krotkiewski H, Lisowska E, Nilsson B

    PubMed: 1929437 Year: 1991

  5. Alkali-labile oligosaccharide units of a sialoglycoprotein from rabbit erythrocyte membranes.

    Fukuda K, Honma K, Manabe H, Utsumi H, Hamada A

    PubMed: 3663707 Year: 1987

  6. See more references
    ● ● ●